Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase
LigandBDBM50022772
Substrate/Competitorn/a
Meas. Tech.ChEBML_27978
IC50 480±n/a nM
Citation Yu, QSAtack, JRRapoport, SIBrossi, A Synthesis and anticholinesterase activity of (-)-N1-norphysostigmine, (-)-eseramine, and other N(1)-substituted analogues of (-)-physostigmine. J Med Chem31:2297-300 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholinesterase
Name:Acetylcholinesterase
Synonyms:Acetylcholinesterase (AChE) | Acetylcholinesterase (EeAChE)
Type:Enzyme
Mol. Mass.:71812.79
Organism:Electrophorus electricus (Electric eel)
Description:n/a
Residue:633
Sequence:
MKILDALLFPVIFIMFFIHLSIAQTDPELTIMTRLGQVQGTRLPVPDRSHVIAFLGIPFA
EPPLGKMRFKPPEPKKPWNDVFDARDYPSACYQYVDTSYPGFSGTEMWNPNRMMSEDCLY
LNVWVPATPRPHNLTVMVWIYGGGFYSGSSSLDVYDGRYLAHSEKVVVVSMNYRVSAFGF
LALNGSAEAPGNVGLLDQRLALQWVQDNIHFFGGNPKQVTIFGESAGAASVGMHLLSPDS
RPKFTRAILQSGVPNGPWRTVSFDEARRRAIKLGRLVGCPDGNDTDLIDCLRSKQPQDLI
DQEWLVLPFSGLFRFSFVPVIDGVVFPDTPEAMLNSGNFKDTQILLGVNQNEGSYFLIYG
APGFSKDNESLITREDFLQGVKMSVPHANEIGLEAVILQYTDWMDEDNPIKNREAMDDIV
GDHNVVCPLQHFAKMYAQYSILQGQTGTASQGNLGWGNSGSASNSGNSQVSVYLYMFDHR
ASNLVWPEWMGVIHGYEIEFVFGLPLEKRLNYTLEEEKLSRRMMKYWANFARTGNPNINV
DGSIDSRRRWPVFTSTEQKHVGLNTDSLKVHKGLKSQFCALWNRFLPRLLNVTENIDDAE
RQWKAEFHRWSSYMMHWKNQFDHYSKQERCTNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022772
NameBDBM50022772
Synonyms:CHEMBL1025 | Diisopropoxyphosphoryl fluoride | Diisopropyl fluorophosphonate | Diisopropyl phosphofluoridate | Diisopropyl phosphorofluoridate | Diisopropylfluorophosphate | Diisopropylfluorophosphoric acid ester | Diisopropylphosphorofluoridate | Fluorodiisopropyl phosphate | ISOFLUROPHATE | Isofluorphate | Isoflurophosphate | Isopropyl fluophosphate | Isopropyl phosphorofluoridate | Neoglaucit | O,O'-Diisopropyl phosphoryl fluoride | bis(propan-2-yl) fluorophosphate | diisopropyl fluorophosphate
TypeSmall organic molecule
Emp. Form.C6H14FO3P
Mol. Mass.184.1457
SMILESCC(C)OP(F)(=O)OC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a