Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM50011566
Substrate/Competitorn/a
Meas. Tech.ChEBML_30977
Ki 180000±n/a nM
Citation Cristalli, GFranchetti, PGrifantini, MVittori, SLupidi, GRiva, FBordoni, TGeroni, CVerini, MA Adenosine deaminase inhibitors. Synthesis and biological activity of deaza analogues of erythro-9-(2-hydroxy-3-nonyl)adenine. J Med Chem31:390-3 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40759.44
Organism:Homo sapiens (Human)
Description:Human recombinant ADA was expressed and purified from an ADA-deficient bacterial strain.
Residue:363
Sequence:
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPD
FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAI
DLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY
HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF
KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAG
QNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011566
NameBDBM50011566
Synonyms:3-(4-Amino-pyrrolo[2,3-d]pyrimidin-7-yl)-nonan-2-ol | CHEMBL18659
TypeSmall organic molecule
Emp. Form.C15H24N4O
Mol. Mass.276.3773
SMILESCCCCCCC(C(C)O)n1ccc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a