Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM50011565
Substrate/Competitorn/a
Meas. Tech.ChEBML_30803
Ki 71000±n/a nM
Citation Cristalli, GFranchetti, PGrifantini, MVittori, SLupidi, GRiva, FBordoni, TGeroni, CVerini, MA Adenosine deaminase inhibitors. Synthesis and biological activity of deaza analogues of erythro-9-(2-hydroxy-3-nonyl)adenine. J Med Chem31:390-3 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:ADA | Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40910.44
Organism:Bos taurus (bovine)
Description:n/a
Residue:363
Sequence:
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011565
NameBDBM50011565
Synonyms:3-(4-Amino-benzoimidazol-1-yl)-nonan-2-ol | CHEMBL17822
TypeSmall organic molecule
Emp. Form.C16H25N3O
Mol. Mass.275.3892
SMILESCCCCCCC(C(C)O)n1cnc2c(N)cccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a