Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50023840
Substrate/Competitorn/a
Meas. Tech.ChEBML_61437
IC50>1000±n/a nM
Citation Monkovic, IWillner, DAdam, MABrown, MCrenshaw, RRFuller, CEJuby, PFLuke, GMMatiskella, JAMontzka, TA Substituted benzamides. 1. Potential nondopaminergic antagonists of chemotherapy-induced nausea and emesis. J Med Chem31:1548-58 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50023840
NameBDBM50023840
Synonyms:3-Amino-2-chloro-11-ethyl-6,7,10,11,12,13,14,15-octahydro-9H-5,8-dioxa-11,15-diaza-benzocyclotetradecen-16-one | CHEMBL41530
TypeSmall organic molecule
Emp. Form.C16H24ClN3O3
Mol. Mass.341.833
SMILESCCN1CCCNC(=O)c2cc(Cl)c(N)cc2OCCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a