Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM82071
Substrate/Competitorn/a
Meas. Tech.ChEBML_88911
IC50 90±n/a nM
Citation Yardley, JPHusbands, GEStack, GButch, JBicksler, JMoyer, JAMuth, EAAndree, TFletcher, HJames, MN 2-Phenyl-2-(1-hydroxycycloalkyl)ethylamine derivatives: synthesis and antidepressant activity. J Med Chem33:2899-905 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1A adrenergic receptor
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Adrenaline | Adrenaline 1 | Alpha-1 adrenoreceptor | adrenergic Alpha1A
Type:Protein
Mol. Mass.:51620.15
Organism:Rattus norvegicus (Rat)
Description:P43140
Residue:466
Sequence:
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82071
NameBDBM82071
Synonyms:CAS_93413-69-5 | CAS_99300-78-4 | NSC_62923 | VENLAFAXINE | Venlafaxine hydrochloride | WY-45030 | WY-45655
TypeSmall organic molecule
Emp. Form.C17H27NO2
Mol. Mass.277.4018
SMILESCOc1ccc(cc1)C(CN(C)C)C1(O)CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a