Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNorepinephrine Monoamine transporters
LigandBDBM50010872
Substrate/Competitorn/a
Meas. Tech.ChEBML_177401
IC50 210±n/a nM
Citation Yardley, JPHusbands, GEStack, GButch, JBicksler, JMoyer, JAMuth, EAAndree, TFletcher, HJames, MN 2-Phenyl-2-(1-hydroxycycloalkyl)ethylamine derivatives: synthesis and antidepressant activity. J Med Chem33:2899-905 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Norepinephrine Monoamine transporters
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66787.87
Organism:Rattus norvegicus
Description:ChEMBL_1463061
Residue:597
Sequence:
MVTRTRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLF
YMELALGQFNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLN
LPWTNCGHAWNSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI
GLPQWQLLLCLMVVIVVLYVSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNG
INAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTIN
CVTSFISGFAIFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFL
MLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLT
LLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLL
FVVVVSIINFKPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAY
GITPENEHHLLALEIELSSLQSFVITSCPIDPLLSSFLFISCQKTLVFKKSGPAPLI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010872
NameBDBM50010872
Synonyms:1-[1-(4-Bromo-phenyl)-2-dimethylamino-ethyl]-cyclohexanol (HCl) | CHEMBL99175
TypeSmall organic molecule
Emp. Form.C16H24BrNO
Mol. Mass.326.272
SMILESCN(C)CC(c1ccc(Br)cc1)C1(O)CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a