Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent serotonin transporter
LigandBDBM50010880
Substrate/Competitorn/a
Meas. Tech.ChEBML_177402
IC50 1540±n/a nM
Citation Yardley, JPHusbands, GEStack, GButch, JBicksler, JMoyer, JAMuth, EAAndree, TFletcher, HJames, MN 2-Phenyl-2-(1-hydroxycycloalkyl)ethylamine derivatives: synthesis and antidepressant activity. J Med Chem33:2899-905 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent serotonin transporter
Name:Monoamine transporters; Norepinephrine & serotonin
Synonyms:5-HT Transporter | 5-HTT | 5HT transporter | 5HTT | Anandamid membrane transporter, AMT | Anandamide membrane transporter, AMT | Sodium-dependent serotonin transporter (SERT) | imipramine receptor
Type:Multi-pass membrane protein
Mol. Mass.:70168.43
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:630
Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010880
NameBDBM50010880
Synonyms:1-(2-Dimethylamino-1-p-tolyl-ethyl)-cyclohexanol (HCl) | CHEMBL99670
TypeSmall organic molecule
Emp. Form.C17H27NO
Mol. Mass.261.4024
SMILESCN(C)CC(c1ccc(C)cc1)C1(O)CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a