Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPepsin A
LigandBDBM50010416
Substrate/Competitorn/a
Meas. Tech.ChEBML_153980
IC50 4200±n/a nM
Citation Raddatz, PJonczyk, AMinck, KOSchmitges, CJSombroek, J Substrate analogue renin inhibitors containing replacements of histidine in P2 or isosteres of the amide bond between P3 and P2 sites. J Med Chem34:3267-80 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pepsin A
Name:Pepsin A
Synonyms:Pepsin | Pepsin A precursor
Type:Enzyme
Mol. Mass.:41232.87
Organism:Porcine
Description:n/a
Residue:385
Sequence:
MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALI
GDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDS
STFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGIL
GLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNW
VPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENS
DGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWIL
GDVFIRQYYTVFDRANNKVGLAPVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010416
NameBDBM50010416
Synonyms:CHEMBL324692 | [[4-(Ethoxycarbonyl)piperdino]carbonyl]-Phe-beta-Ala-ACHPA-Ile N-[(4-amino-2-methyl-5-pyrimidinyl)methyl]amide
TypeSmall organic molecule
Emp. Form.C44H67N9O8
Mol. Mass.850.0583
SMILESCCOC(=O)C1CCN(CC1)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCCC(=O)N[C@@H](CC1CCCCC1)[C@@H](O)CC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCc1cnc(C)nc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a