Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin D
LigandBDBM50010412
Substrate/Competitorn/a
Meas. Tech.ChEBML_216563
IC50 8800±n/a nM
Citation Raddatz, PJonczyk, AMinck, KOSchmitges, CJSombroek, J Substrate analogue renin inhibitors containing replacements of histidine in P2 or isosteres of the amide bond between P3 and P2 sites. J Med Chem34:3267-80 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin D
Name:Cathepsin D
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42158.92
Organism:Bos taurus
Description:ChEMBL_1458606
Residue:387
Sequence:
VIRIPLHKFTSIRRTMSEAAGVLIAKGPISKYATGEPAVRQGPIPELLKNYMDAQYYGEI
GIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSSTYVKNGTTFDIHYG
SGSLSGYLSQDTVSVPCNPSSSSPGGVTVQRQTFGEAIKQPGVVFIAAKFDGILGMAYPR
ISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQPGGELMLGGTDSKYYRGSLMFHNVT
RQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEY
MIPCEKVSSLPEVTVKLGGKDYALSPEDYALKVSQAETTVCLSGFMGMDIPPPGGPLWIL
GDVFIGRYYTVFDRDQNRVGLAEAARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010412
NameBDBM50010412
Synonyms:BOC-Phe-psi[COCH2S]Gly-Leu-psi-[CHOHCH2]Val-Ile N-[(4-amino-2-methyl-5-pyrimidinyl)methyl]amide | CHEMBL324213
TypeSmall organic molecule
Emp. Form.C41H65N7O7S
Mol. Mass.800.063
SMILESCC[C@H](C)[C@H](NC(=O)[C@@H](C[C@H](O)[C@H](CC(C)C)NC(=O)CSCC(=O)[C@H](Cc1ccccc1)NC(=O)OC(C)(C)C)C(C)C)C(=O)NCc1cnc(C)nc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a