Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde reductase
LigandBDBM50009834
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31308
IC50 89000±n/a nM
Citation Mylari, BLBeyer, TASiegel, TW A highly specific aldose reductase inhibitor, ethyl 1-benzyl-3-hydroxy-2(5H)-oxopyrrole-4-carboxylate, and its congeners. J Med Chem34:1011-8 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde reductase
Name:Aldehyde reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36541.05
Organism:Sus scrofa
Description:ChEMBL_615076
Residue:325
Sequence:
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEAL
TETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEK
YNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALNKNLRFIV
PMLTVDGKRVPRDAGHPLYPFNDPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009834
NameBDBM50009834
Synonyms:2-Propylvaleric acid sodium salt | CHEMBL433 | Depakene | Depakote | Divalproex | Divalproex sodium | Epilim | VALPROATE SODIUM | sodium 2-propylpentanoate | sodium valproate
TypeSmall organic molecule
Emp. Form.C8H15O2
Mol. Mass.143.204
SMILESCCCC(CCC)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a