Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase
LigandBDBM50009847
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32093
IC50 910±n/a nM
Citation Mylari, BLBeyer, TASiegel, TW A highly specific aldose reductase inhibitor, ethyl 1-benzyl-3-hydroxy-2(5H)-oxopyrrole-4-carboxylate, and its congeners. J Med Chem34:1011-8 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase
Name:Aldose reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35797.87
Organism:Rattus norvegicus
Description:ChEMBL_1512484
Residue:316
Sequence:
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009847
NameBDBM50009847
Synonyms:CHEMBL428672 | ethyl 6-fluoro-4',5'-dioxospiro[3,4-dihydro-2H-chromene-4,2'-(tetrahydro-1'H-pyrrole)]-3'-carboxylate
TypeSmall organic molecule
Emp. Form.C15H14FNO5
Mol. Mass.307.2738
SMILESCCOC(=O)C1C(=O)C(=O)NC11CCOc2ccc(F)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a