Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin-H2 D-isomerase
LigandBDBM50009859
Substrate/Competitorn/a
Meas. Tech.ChEBML_158157
IC50 13000±n/a nM
Citation Bell, MRD'Ambra, TEKumar, VEissenstat, MAHerrmann, JLWetzel, JRRosi, DPhilion, REDaum, SJHlasta, DJ Antinociceptive (aminoalkyl)indoles. J Med Chem34:1099-110 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin-H2 D-isomerase
Name:Prostaglandin-H2 D-isomerase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:21069.88
Organism:Mus musculus
Description:ChEMBL_158158
Residue:189
Sequence:
MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKA
VLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSV
VEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFL
PQPDKCIQE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009859
NameBDBM50009859
Synonyms:(+-)-2-(p-isobutylphenyl)propionic acid | (+-)-alpha-methyl-4-(2-methylpropyl)benzeneacetic acid | (+-)-ibuprofen | (+-)-p-isobutylhydratropic acid | (4-isobutylphenyl)-alpha-methylacetic acid | (RS)-ibuprofen | 2-(4-isobutylphenyl)propanoic acid | 2-[4-(2-methylpropyl)phenyl]propanoic acid | 4-isobutylhydratropic acid | Advil | Brufen | CHEMBL521 | IBUPROFEN LYSINE | Ibuprofen | Ibuprofen (1) | Motrin | alpha-(4-isobutylphenyl)propionic acid | alpha-(p-isobutylphenyl)propionic acid
TypeSmall organic molecule
Emp. Form.C13H18O2
Mol. Mass.206.2808
SMILESCC(C)Cc1ccc(cc1)C(C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a