Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin E
LigandBDBM50011703
Substrate/Competitorn/a
Meas. Tech.ChEBML_45331
IC50>10000±n/a nM
Citation Williams, PDPerlow, DSPayne, LSHolloway, MKSiegl, PKSchorn, TWLynch, RJDoyle, JJStrouse, JFVlasuk, GP Renin inhibitors containing conformationally restricted P1-P1' dipeptide mimetics. J Med Chem34:887-900 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin E
Name:Cathepsin E
Synonyms:n/a
Type:Enzyme
Mol. Mass.:43298.99
Organism:Homo sapiens (Human)
Description:P14091
Residue:401
Sequence:
MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESC
SMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRF
QPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSAFATQVEGLTVVGQQFGESVTEPGQT
FVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGG
YDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIK
QLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGF
QGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011703
NameBDBM50011703
Synonyms:CHEMBL355128 | {1-[1-[1-Cyclohexylmethyl-2-hydroxy-2-(1-methyl-2-oxo-pyrrolidin-3-yl)-ethylcarbamoyl]-2-(1H-imidazol-4-yl)-ethylcarbamoyl]-2-phenyl-ethyl}-carbamic acid tert-butyl ester
TypeSmall organic molecule
Emp. Form.C34H50N6O6
Mol. Mass.638.7974
SMILESCN1CC[C@@H]([C@H](O)[C@H](CC2CCCCC2)NC(=O)[C@H](Cc2cnc[nH]2)NC(=O)[C@H](Cc2ccccc2)NC(=O)OC(C)(C)C)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a