Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50011851
Substrate/Competitorn/a
Meas. Tech.ChEBML_138564
Ki 0.472000±n/a nM
Citation Carroll, FIAbraham, PMascarella, SWSingh, PMoreland, CGSankar, SSKwon, YWTriggle, DJ Crystal, solution, and molecular modeling structural properties and muscarinic antagonist activity of azaprophen. J Med Chem34:1436-40 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M4
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011851
NameBDBM50011851
Synonyms:2,2-Diphenyl-propionic acid 6-methyl-6-aza-bicyclo[3.2.1]oct-3-yl ester | 2,2-Diphenyl-propionic acid 6-methyl-6-aza-bicyclo[3.2.1]oct-3-yl ester (azaprophen) | CHEMBL287868
TypeSmall organic molecule
Emp. Form.C23H27NO2
Mol. Mass.349.466
SMILESCN1CC2CC1CC(C2)OC(=O)C(C)(c1ccccc1)c1ccccc1 |TLB:9:7:1.2:4,THB:0:1:4:6.7.8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a