Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 3 receptor
LigandBDBM50002462
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209702
IC50 3300±n/a nM
Citation Appell, KCBabb, BEGoswami, RHall, PLLawrence, KBLogan, MEPrzyklek-Elling, RTomczuk, BEVenepalli, BRYanni, JM Imidazo[4,5-b]quinoxaline cyanines as neurokinin antagonists. J Med Chem34:1751-3 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neurokinin 3 receptor
Name:Neurokinin 3 receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:51128.60
Organism:Rattus norvegicus
Description:ChEMBL_10983
Residue:452
Sequence:
MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRAN
LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS
VAAFNTLINFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP
RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII
LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL
PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW
CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRD
PSANGCSHRGSKSASTTSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002462
NameBDBM50002462
Synonyms:1,3-Diethyl-2-[3-(1,3,3-trimethyl-1,3-dihydro-indol-2-ylidene)-propenyl]-3H-imidazo[4,5-b]quinoxalin-1-ium; chloride | 1,3-Diethyl-2-[3-(1,3,3-trimethyl-1,3-dihydro-indol-2-ylidene)-propenyl]-3H-naphtho[2,3-d]imidazol-1-ium; chloride | CHEMBL278294
TypeSmall organic molecule
Emp. Form.C27H30N5
Mol. Mass.424.5601
SMILESCCn1c(\C=C\C=C2/N(C)c3ccccc3C2(C)C)[n+](CC)c2nc3ccccc3nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a