Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50009326
Substrate/Competitorn/a
Meas. Tech.ChEBML_159122
Ki 360±n/a nM
Citation Thaisrivongs, STomasselli, AGMoon, JBHui, JMcQuade, TJTurner, SRStrohbach, JWHowe, WJTarpley, WGHeinrikson, RL Inhibitors of the protease from human immunodeficiency virus: design and modeling of a compound containing a dihydroxyethylene isostere insert with high binding affinity and effective antiviral activity. J Med Chem34:2344-56 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009326
NameBDBM50009326
Synonyms:CHEMBL76484 | {1-[1-(2,3-Dihydroxy-1-isobutyl-4-isopropyl-9-methylamino-5-oxo-nonylcarbamoyl)-2-(1H-imidazol-4-yl)-ethylcarbamoyl]-2-phenyl-ethyl}-carbamic acid tert-butyl ester
TypeSmall organic molecule
Emp. Form.C37H60N6O7
Mol. Mass.700.9083
SMILESCNCCCCC(=O)[C@H](C(C)C)[C@@H](O)[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H](Cc1ccccc1)NC(=O)OC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a