Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; Norepininephrine & dopamine
LigandBDBM50229945
Substrate/Competitorn/a
Meas. Tech.ChEBML_61994
IC50 4950±n/a nM
Citation Abraham, PPitner, JBLewin, AHBoja, JWKuhar, MJCarroll, FI N-modified analogues of cocaine: synthesis and inhibition of binding to the cocaine receptor. J Med Chem35:141-4 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; Norepininephrine & dopamine
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:DA transporter | Sodium-dependent dopamine transporter | Sodium-dependent dopamine transporter (DAT)
Type:Multi-pass membrane protein
Mol. Mass.:68749.45
Organism:Rattus norvegicus (rat)
Description:Rat caudate membranes were used as DAT source in binding assay.
Residue:619
Sequence:
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229945
NameBDBM50229945
Synonyms:CHEMBL3349044
TypeSmall organic molecule
Emp. Form.C15H19NO2
Mol. Mass.245.3169
SMILESCN1CC2CC1C[C@H](C2)OC(=O)c1ccccc1 |r,TLB:9:7:1.2:4,THB:0:1:4:6.7.8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a