Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin D
LigandBDBM50006847
Substrate/Competitorn/a
Meas. Tech.ChEBML_44968
IC50 14500±n/a nM
Citation Patt, WCHamilton, HWTaylor, MDRyan, MJTaylor, DGConnolly, CJDoherty, AMKlutchko, SRSircar, ISteinbaugh, BA Structure-activity relationships of a series of 2-amino-4-thiazole-containing renin inhibitors. J Med Chem35:2562-72 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin D
Name:Cathepsin D
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42158.92
Organism:Bos taurus
Description:ChEMBL_1458606
Residue:387
Sequence:
VIRIPLHKFTSIRRTMSEAAGVLIAKGPISKYATGEPAVRQGPIPELLKNYMDAQYYGEI
GIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSSTYVKNGTTFDIHYG
SGSLSGYLSQDTVSVPCNPSSSSPGGVTVQRQTFGEAIKQPGVVFIAAKFDGILGMAYPR
ISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQPGGELMLGGTDSKYYRGSLMFHNVT
RQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEY
MIPCEKVSSLPEVTVKLGGKDYALSPEDYALKVSQAETTVCLSGFMGMDIPPPGGPLWIL
GDVFIGRYYTVFDRDQNRVGLAEAARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006847
NameBDBM50006847
Synonyms:CHEMBL86374 | N-[2-(2-Amino-thiazol-4-yl)-1-(1-cyclohexylmethyl-2,3-dihydroxy-5-methyl-hexylcarbamoyl)-ethyl]-2-(morpholine-4-sulfonylamino)-3-phenyl-propionamide
TypeSmall organic molecule
Emp. Form.C33H52N6O7S2
Mol. Mass.708.932
SMILESCC(C)C[C@H](O)[C@H](O)[C@H](CC1CCCCC1)NC(=O)[C@@H](Cc1csc(N)n1)NC(=O)[C@H](Cc1ccccc1)NS(=O)(=O)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a