Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin D
LigandBDBM50006856
Substrate/Competitorn/a
Meas. Tech.ChEBML_44968
IC50 3700±n/a nM
Citation Patt, WCHamilton, HWTaylor, MDRyan, MJTaylor, DGConnolly, CJDoherty, AMKlutchko, SRSircar, ISteinbaugh, BA Structure-activity relationships of a series of 2-amino-4-thiazole-containing renin inhibitors. J Med Chem35:2562-72 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin D
Name:Cathepsin D
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42158.92
Organism:Bos taurus
Description:ChEMBL_1458606
Residue:387
Sequence:
VIRIPLHKFTSIRRTMSEAAGVLIAKGPISKYATGEPAVRQGPIPELLKNYMDAQYYGEI
GIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSSTYVKNGTTFDIHYG
SGSLSGYLSQDTVSVPCNPSSSSPGGVTVQRQTFGEAIKQPGVVFIAAKFDGILGMAYPR
ISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQPGGELMLGGTDSKYYRGSLMFHNVT
RQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEY
MIPCEKVSSLPEVTVKLGGKDYALSPEDYALKVSQAETTVCLSGFMGMDIPPPGGPLWIL
GDVFIGRYYTVFDRDQNRVGLAEAARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006856
NameBDBM50006856
Synonyms:4-{3-(2-Amino-thiazol-4-yl)-2-[2-(morpholine-4-sulfonylamino)-3-phenyl-propionylamino]-propionylamino}-5-cyclohexyl-2,2-difluoro-3-oxo-pentanoic acid (2-morpholin-4-yl-ethyl)-amide | 4-{3-(2-Amino-thiazol-4-yl)-2-[2-(morpholine-4-sulfonylamino)-3-phenyl-propionylamino]-propionylamino}-5-cyclohexyl-2,2-difluoro-3-oxo-pentanoic acid (2-morpholin-4-yl-ethyl)-amide; Hydrate | CHEMBL405227
TypeSmall organic molecule
Emp. Form.C36H52F2N8O8S2
Mol. Mass.826.974
SMILESNc1nc(C[C@H](NC(=O)[C@H](Cc2ccccc2)NS(=O)(=O)N2CCOCC2)C(=O)N[C@@H](CC2CCCCC2)C(=O)C(F)(F)C(=O)NCCN2CCOCC2)cs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a