Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50004787
Substrate/Competitorn/a
Meas. Tech.ChEMBL_159302
IC50 7000±n/a nM
Citation DeCamp, DLBabé, LMSalto, RLucich, JLKoo, MSKahl, SBCraik, CS Specific inhibition of HIV-1 protease by boronated porphyrins. J Med Chem35:3426-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004787
NameBDBM50004787
Synonyms:CHEMBL442513 | Porphyrin analogue
TypeSmall organic molecule
Emp. Form.C70H74N8O12
Mol. Mass.1219.383
SMILESCN(C)c1ccc(cc1)C(=O)OCC(OC(=O)c1ccc(cc1)N(C)C)c1c(C)c2cc3[nH]c(cc4nc(cc5nc(cc1[nH]2)c(C)c5CCC(O)=O)c(CCC(O)=O)c4C)c(C)c3C(COC(=O)c1ccc(cc1)N(C)C)OC(=O)c1ccc(cc1)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a