Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 2 pol protein
LigandBDBM50004788
Substrate/Competitorn/a
Meas. Tech.ChEBML_159124
IC50 1500±n/a nM
Citation DeCamp, DLBabé, LMSalto, RLucich, JLKoo, MSKahl, SBCraik, CS Specific inhibition of HIV-1 protease by boronated porphyrins. J Med Chem35:3426-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 2 pol protein
Name:Human immunodeficiency virus type 2 pol protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:100453.78
Organism:Human immunodeficiency virus 2
Description:ChEMBL_159124
Residue:876
Sequence:
MTGDTPINIFGRNILTALGMSLNLPVARIEPIKITLKPGKDGPRLKQWPLTKEKVEALKE
ICEKMEKEGQLEEAPPTNPYNTPTFAIKKKDKNKWRMLIDFRELNRVTQDFTEIQLGIPH
PAGLAKKKRITVLDVGDAYFSIPLYEDFRPYTAFTLPSVNNVEPGKRYIYKVLPQGWKGS
PAIFQYTMRQILEPFRKANPDVILIQYMDDILIASDRTGLEHDKVVLQLKELLNGLGFST
PEEKFQKDPPFQWMGYELWPTKWKLQKIQLPQKETWTVNDIQKLVGILNWAAQIYPGIKT
KHLCRLIRGKMTLTEEVQWTELAEAELEENRIILDQEQEGHYYQEEKELEATIQKSQDNQ
WTYKIHQEEKILKVGKYAKIKNTHTNGVRLLAQVVQKIGKEALVIWGRIPKFHLPVERET
WEQWWDNYWQVTWIPEWDFVSTPPLVRLTFNLVGDPIPGTETFYTDGSCNRQSKEGKAGY
VTDRGRDKVRVLEQTTNQQAELEAFAMALADSGPKVNIIVDSQYVMGIVASQPTESESRI
VNQIIEDMIKKEAVYVAWIPAHKGIGGNQEVDHLVSQGIRQVLFLEKIEPAQEEHEKYHS
NIKELIHKFGIPQLVARQIVNTCAQCQQKGEAIHGQVNAEIGVWQMDCTHLEGKIIIVAV
HVASGFIEAEVIPQESGRQTALFLLKLASRWPITHLHTDNGPNFTSQEVKMVAWWVGIEQ
SFGVPYNPQSQGVVEAMNHHLKNQISRIREQANTVETIVLMAVHCMNFKRRGGIGDMTPA
ERLINMITTEQEIQFLQRKNSNFKKFQVYYREGRDQLWKGPGELLWKGEGAVIVKVGADI
KVVPRRKAKIIRDYGGRQELDSSPHLEGAREDGEVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004788
NameBDBM50004788
Synonyms:3-[18-(2-Carboxy-ethyl)-8,13-bis-(1,2-diacetoxy-ethyl)-3,7,12,17-tetramethyl-22,24-dihydro-porphin-2-yl]-propionic acid;Co complex | CHEMBL430519
TypeSmall organic molecule
Emp. Form.C50H44CoN4O12
Mol. Mass.951.8372
SMILESCC1=C(CCC(O)=O)\C2=C\c3c(CCC(O)=O)c(C)c4\C=C5/N=C(/C=c6/c(C(COC(=O)C7=CC7)OC(=O)C7=CC7)c(C)\c(=C\C1=N2)n6[Co]n34)C(C)=C5C(COC(=O)C1=CC1)OC(=O)C1=CC1 |c:1,20,48,58,t:8,22,24,32,39,45,66,73|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a