Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 2 pol protein
LigandBDBM50004790
Substrate/Competitorn/a
Meas. Tech.ChEBML_159124
IC50 23000±n/a nM
Citation DeCamp, DLBabé, LMSalto, RLucich, JLKoo, MSKahl, SBCraik, CS Specific inhibition of HIV-1 protease by boronated porphyrins. J Med Chem35:3426-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 2 pol protein
Name:Human immunodeficiency virus type 2 pol protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:100453.78
Organism:Human immunodeficiency virus 2
Description:ChEMBL_159124
Residue:876
Sequence:
MTGDTPINIFGRNILTALGMSLNLPVARIEPIKITLKPGKDGPRLKQWPLTKEKVEALKE
ICEKMEKEGQLEEAPPTNPYNTPTFAIKKKDKNKWRMLIDFRELNRVTQDFTEIQLGIPH
PAGLAKKKRITVLDVGDAYFSIPLYEDFRPYTAFTLPSVNNVEPGKRYIYKVLPQGWKGS
PAIFQYTMRQILEPFRKANPDVILIQYMDDILIASDRTGLEHDKVVLQLKELLNGLGFST
PEEKFQKDPPFQWMGYELWPTKWKLQKIQLPQKETWTVNDIQKLVGILNWAAQIYPGIKT
KHLCRLIRGKMTLTEEVQWTELAEAELEENRIILDQEQEGHYYQEEKELEATIQKSQDNQ
WTYKIHQEEKILKVGKYAKIKNTHTNGVRLLAQVVQKIGKEALVIWGRIPKFHLPVERET
WEQWWDNYWQVTWIPEWDFVSTPPLVRLTFNLVGDPIPGTETFYTDGSCNRQSKEGKAGY
VTDRGRDKVRVLEQTTNQQAELEAFAMALADSGPKVNIIVDSQYVMGIVASQPTESESRI
VNQIIEDMIKKEAVYVAWIPAHKGIGGNQEVDHLVSQGIRQVLFLEKIEPAQEEHEKYHS
NIKELIHKFGIPQLVARQIVNTCAQCQQKGEAIHGQVNAEIGVWQMDCTHLEGKIIIVAV
HVASGFIEAEVIPQESGRQTALFLLKLASRWPITHLHTDNGPNFTSQEVKMVAWWVGIEQ
SFGVPYNPQSQGVVEAMNHHLKNQISRIREQANTVETIVLMAVHCMNFKRRGGIGDMTPA
ERLINMITTEQEIQFLQRKNSNFKKFQVYYREGRDQLWKGPGELLWKGEGAVIVKVGADI
KVVPRRKAKIIRDYGGRQELDSSPHLEGAREDGEVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004790
NameBDBM50004790
Synonyms:CHEMBL384612 | Porphyrin analogue
TypeSmall organic molecule
Emp. Form.C78H62N4O12
Mol. Mass.1247.3465
SMILESCc1c(CCC(O)=O)c2cc3nc(cc4[nH]c(cc5[nH]c(cc1n2)c(C)c5C(COC(=O)c1ccc2ccccc2c1)OC(=O)c1ccc2ccccc2c1)c(C)c4C(COC(=O)c1ccc2ccccc2c1)OC(=O)c1ccc2ccccc2c1)c(C)c3CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a