Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50368431
Substrate/Competitorn/a
Meas. Tech.ChEBML_157563
Ki 2.4±n/a nM
Citation Rich, DHPrasad, JVSun, CQGreen, JMueller, RHouseman, KMacKenzie, DMalkovsky, M New hydroxyethylamine HIV protease inhibitors that suppress viral replication. J Med Chem35:3803-12 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50368431
NameBDBM50368431
Synonyms:CHEMBL1790869 | CHEMBL3349480
TypeSmall organic molecule
Emp. Form.C42H54N6O9
Mol. Mass.786.913
SMILES[H][C@@](O)(CN1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](Cc1ccccc1)C(O)=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a