Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTACR2
LigandBDBM50001455
Substrate/Competitorn/a
Meas. Tech.ChEBML_208846
IC50 10±n/a nM
Citation Harbeson, SLShatzer, SALe, TBBuck, SH A new class of high affinity ligands for the neurokinin A NK2 receptor: psi (CH2NR) reduced peptide bond analogues of neurokinin A4-10. J Med Chem35:3949-55 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TACR2
Name:Neurokinin 2 receptor
Synonyms:Neurokinin NK2 | Substance-K receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43436.75
Organism:HAMSTER
Description:P51144
Residue:384
Sequence:
MGGRAIVTDTNIFSGLESNTTGVTAFSMPAWQLALWATAYLGLVLVAVTGNATVIWIILA
HERMRTVTNYFIINLALADLCMAAFNATFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPITKATIAGIWLVALALASPQCFYSTITVDQGATK
CVVAWPNDNGGKMLLLYHLVVFVLVYFLPLVVMFVAYSVIGLTLWKRAVPRHQAHGANLR
HLHAKKKFVKAMVLVVLTFAICWLPYHLYFILGSFQKDIYYRKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTRTPSLSRRVNRCHTKETLFMT
ADMTHSEATNGQVGSPQDVEPAAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001455
NameBDBM50001455
Synonyms:3-Amino-N-(1-{1-[1-(2-{1-[(1-carbamoyl-2-phenyl-ethylamino)-methyl]-3-methyl-butylcarbamoyl}-ethylcarbamoyl)-2-methyl-propylcarbamoyl]-2-phenyl-ethylcarbamoyl}-2-hydroxy-ethyl)-succinamic acid | CHEMBL126776
TypeSmall organic molecule
Emp. Form.C39H58N8O9
Mol. Mass.782.926
SMILESCC(C)C[C@@H](CN[C@@H](Cc1ccccc1)C(N)=O)NC(=O)CCNC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(O)=O)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a