Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA receptor alpha-1 subunit
LigandBDBM50001556
Substrate/Competitorn/a
Meas. Tech.ChEBML_69323
IC50 800±n/a nM
Citation Melikian, ASchlewer, GChambon, JPWermuth, CG Condensation of muscimol or thiomuscimol with aminopyridazines yields GABA-A antagonists. J Med Chem35:4092-7 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA receptor alpha-1 subunit
Name:GABA-A receptor; anion channel
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51770.21
Organism:Mus musculus
Description:ChEMBL_69323
Residue:455
Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001556
NameBDBM50001556
Synonyms:4-(6-Imino-5-methyl-3-phenyl-6H-pyridazin-1-yl)-butyric acid | CHEMBL132561
TypeSmall organic molecule
Emp. Form.C15H17N3O2
Mol. Mass.271.3144
SMILESCc1cc(nn(CCCC(O)=O)c1=N)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a