Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTACR2
LigandBDBM50001598
Substrate/Competitorn/a
Meas. Tech.ChEBML_209227
EC50 2104±n/a nM
Citation Deal, MJHagan, RMIreland, SJJordan, CCMcElroy, ABPorter, BRoss, BCStephens-Smith, MWard, P Conformationally constrained tachykinin analogues: potent and highly selective neurokinin NK-2 receptor agonists. J Med Chem35:4195-204 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TACR2
Name:Neurokinin 2 receptor
Synonyms:NK-2 receptor | NK-2R | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | SKR | Substance-K receptor | Tachykinin receptor 2
Type:Enzyme Catalytic Domain
Mol. Mass.:43868.63
Organism:mouse
Description:Neurokinin NK2 TACR2 Murine::P16610
Residue:390
Sequence:
MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA
HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQCFYSTITVDEGATK
CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLLVMFGAYSVIGLTLWKRAVPRHQAHGANLR
HLQAKKKFVKAMVLVVLTFAICWLPYHLYFILGTFQEDIYYHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTHTPSLSRRVNRCHTKETLFMT
GDMTHSEATNGQVGSPQDGEPAGPICKAQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001598
NameBDBM50001598
Synonyms:2-(1-{2-[2-(5-Amino-pentanoylamino)-3-phenyl-propionylamino]-3-phenyl-propionyl}-6-oxo-hexahydro-pyrrolo[3,4-b]pyrrol-5-yl)-4-methyl-pentanoic acid (1-carbamoyl-3-methylsulfanyl-propyl)-amide | CHEMBL337037
TypeSmall organic molecule
Emp. Form.C40H57N7O6S
Mol. Mass.763.989
SMILESCSCC[C@H](NC(=O)[C@@H](CC(C)C)N1C[C@H]2CCN([C@H]2C1=O)C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)CCCCN)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a