Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 3 receptor
LigandBDBM50079412
Substrate/Competitorn/a
Meas. Tech.ChEBML_209701
EC50 6.3±n/a nM
Citation Deal, MJHagan, RMIreland, SJJordan, CCMcElroy, ABPorter, BRoss, BCStephens-Smith, MWard, P Conformationally constrained tachykinin analogues: potent and highly selective neurokinin NK-2 receptor agonists. J Med Chem35:4195-204 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neurokinin 3 receptor
Name:Neurokinin 3 receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:51128.60
Organism:Rattus norvegicus
Description:ChEMBL_10983
Residue:452
Sequence:
MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRAN
LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS
VAAFNTLINFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP
RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII
LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL
PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW
CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRD
PSANGCSHRGSKSASTTSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079412
NameBDBM50079412
Synonyms:(NKB)Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 | Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 | Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2(Neurokinin B) | CHEMBL437797 | NKB | Neurokinin B
TypeSmall organic molecule
Emp. Form.C55H79N13O14S2
Mol. Mass.1210.424
SMILESCSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a