Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmu/kappa opioid receptor
LigandBDBM50002350
Substrate/Competitorn/a
Meas. Tech.ChEBML_146266
Ki 11±n/a nM
Citation Choi, HMurray, TFDeLander, GECaldwell, VAldrich, JV N-terminal alkylated derivatives of [D-Pro10]dynorphin A-(1-11) are highly selective for kappa-opioid receptors. J Med Chem35:4638-9 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mu/kappa opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:OPIATE Mu OPRM1 GUINEA PIG::P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002350
NameBDBM50002350
Synonyms:CHEMBL265387 | [N-allylTyr1, D-pro10]Dynorphin A(1-11)
TypeSmall organic molecule
Emp. Form.C66H107N21O13
Mol. Mass.1402.6887
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NCC=C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@@H]1C(=O)N[C@@H](CCCCN)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a