Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-citrate synthase
LigandBDBM50004264
Substrate/Competitorn/a
Meas. Tech.ChEBML_29531
Ki>20000000±n/a nM
Citation McNair, DHughes, MJEggelston, D ATP-citrate lyase as a target for hypolipidemic intervention. Sulfoximine and 3-hydroxy-beta-lactam containing analogues of citric acid as potential tight-binding inhibitors. J Med Chem35:4875-84 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATP-citrate synthase
Name:ATP-citrate synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:120645.65
Organism:Rattus norvegicus
Description:ChEMBL_857791
Residue:1100
Sequence:
MSAKAISEQTGKELLYKYICTTSAIQNRFKYARVTPDTDWAHLLQDHPWLLSQSLVVKPD
QLIKRRGKLGLVGVNLSLDGVKSWLKPRLGHEATVGKAKGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDTKAQKLLVGVDEKLNAEDIKRHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYILDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGSLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMAWA
PAIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVPS
PRSLQGKSATLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKF
YWGHKEILIPVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGI
PEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVS
RSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGG
TEEYKICRGIKEGRLTKPVVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALKE
AGVFVPRSFDELGEIIQSVYEDLVAKGAIVPAQEVPPPTVPMDYSWARELGLIRKPASFM
TSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQRRLPKYSCQFIEMCLMVTADHG
PAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVN
KMKKEGKLIMGIGHRVKSINNPDMRVQILKDFVKQHFPATPLLDYALEVEKITTSKKPNL
ILNVDGFIGVAFVDMLRNCGSFTREEADEYVDIGALNGVFVLGRSMGFIGHYLDQKRLKQ
GLYRHPWDDISYVLPEHMSM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004264
NameBDBM50004264
Synonyms:2-(3-Hydroxy-2-oxo-azetidin-3-ylmethyl)-succinic acid | CHEMBL144869
TypeSmall organic molecule
Emp. Form.C8H11NO6
Mol. Mass.217.176
SMILESOC(=O)C[C@H](C[C@@]1(O)CNC1=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a