Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50005150
Substrate/Competitorn/a
Meas. Tech.ChEBML_63659
IC50 5000±n/a nM
Citation Skiles, JWFuchs, VMiao, CSorcek, RGrozinger, KGMauldin, SCVitous, JMui, PWJacober, SChow, G Inhibition of human leukocyte elastase (HLE) by N-substituted peptidyl trifluoromethyl ketones. J Med Chem35:641-62 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005150
NameBDBM50005150
Synonyms:4-(4-Chloro-benzenesulfonylaminocarbonyl)-N-(1-{indan-2-yl-[2-(3,3,3-trifluoro-1-isopropyl-2-oxo-propylamino)-ethyl]-carbamoyl}-2-methyl-propyl)-benzamide | CHEMBL158824
TypeSmall organic molecule
Emp. Form.C36H40ClF3N4O6S
Mol. Mass.749.239
SMILESCC(C)C(NCCN(C1Cc2ccccc2C1)C(=O)C(NC(=O)c1ccc(cc1)C(=O)NS(=O)(=O)c1ccc(Cl)cc1)C(C)C)C(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a