Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThermolysin
LigandBDBM50044226
Substrate/Competitorn/a
Meas. Tech.ChEBML_210395
IC50 7±n/a nM
Citation Patchett, AA Excursions in drug discovery. J Med Chem36:2051-8 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thermolysin
Name:Thermolysin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60097.54
Organism:Bacillus thermoproteolyticus
Description:ChEMBL_1468794
Residue:548
Sequence:
MKMKMKLASFGLAAGLAAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKVNGTSPEEL
VYQYVEKNENKFKFHENAKDTLQLKEKKNDNLGFTFMRFQQTYKGIPVFGAVVTSHVKDG
TLTALSGTLIPNLDTKGSLKSGKKLSEKQARDIAEKDLVANVTKEVPEYEQGKDTEFVVY
VNGDEASLAYVVNLNFLTPEPGNWLYIIDAVDGKILNKFNQLDAAKPGDVKSITGTSTVG
VGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDA
PAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQ
TFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEI
GEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGG
THYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQ
AFDAVGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50044226
NameBDBM50044226
Synonyms:1-hydroxy-1-phenylethyl-phosphinoylamino]-propionyl-pyrrolidine-2-carboxylic acid | CHEMBL62955 | Compound 16
TypeSmall organic molecule
Emp. Form.C16H23N2O5P
Mol. Mass.354.338
SMILESCC(NP(O)(=O)CCc1ccccc1)C(=O)N1CCCC1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a