Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM50018420
Substrate/Competitorn/a
Meas. Tech.ChEBML_29423
Ki 6.6±n/a nM
Citation Suzuki, FShimada, JShiozaki, SIchikawa, SIshii, ANakamura, JNonaka, HKobayashi, HFuse, E Adenosine A1 antagonists. 3. Structure-activity relationships on amelioration against scopolamine- or N6-((R)-phenylisopropyl)adenosine-induced cognitive disturbance. J Med Chem36:2508-18 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:A1 adenosine receptor | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | ADORA1 | Adenosine Receptor A1
Type:Enzyme Catalytic Domain
Mol. Mass.:36501.39
Organism:GUINEA PIG
Description:ADENOSINE A1 ADORA1 GUINEA PIG::P47745
Residue:326
Sequence:
MPHSVSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAAVAIAGCWILSLVVGLTPMFGWNNLSKIEMAWAANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCHKPTILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPEPPIDEDLPEEKVDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018420
NameBDBM50018420
Synonyms:8-Cyclopentyl-1,3-dipropyl-2-thioxo-1,2,3,7-tetrahydro-purin-6-one | CHEMBL292904
TypeSmall organic molecule
Emp. Form.C16H24N4OS
Mol. Mass.320.453
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=S)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a