Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50003018
Substrate/Competitorn/a
Meas. Tech.ChEBML_28962
Ki 11±n/a nM
Citation Suzuki, FShimada, JShiozaki, SIchikawa, SIshii, ANakamura, JNonaka, HKobayashi, HFuse, E Adenosine A1 antagonists. 3. Structure-activity relationships on amelioration against scopolamine- or N6-((R)-phenylisopropyl)adenosine-induced cognitive disturbance. J Med Chem36:2508-18 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (Human)
Description:P30542
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003018
NameBDBM50003018
Synonyms:8-(3-Oxo-cyclopentyl)-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | CHEMBL84545
TypeSmall organic molecule
Emp. Form.C16H22N4O3
Mol. Mass.318.3709
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C1CCC(=O)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a