Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine kinase
LigandBDBM50368708
Substrate/Competitorn/a
Meas. Tech.ChEBML_30640
Ki 300±n/a nM
Citation Cottam, HBWasson, DBShih, HCRaychaudhuri, ADi Pasquale, GCarson, DA New adenosine kinase inhibitors with oral antiinflammatory activity: synthesis and biological evaluation. J Med Chem36:3424-30 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine kinase
Name:Adenosine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40545.97
Organism:Homo sapiens (Human)
Description:ChEMBL_1467841
Residue:362
Sequence:
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAED
KHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKA
AEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKAR
VCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN
ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA
VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD
FH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50368708
NameBDBM50368708
Synonyms:CHEMBL611890
TypeSmall organic molecule
Emp. Form.C10H11ClIN5O3
Mol. Mass.411.584
SMILESNc1ncnc2n(nc(I)c12)C1O[C@H](CCl)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a