Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTACR2
LigandBDBM50030150
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143188
IC50 6000±n/a nM
Citation Josien, HLavielle, SBrunissen, ASaffroy, MTorrens, YBeaujouan, JCGlowinski, JChassaing, G Design and synthesis of side-chain conformationally restricted phenylalanines and their use for structure-activity studies on tachykinin NK-1 receptor. J Med Chem37:1586-601 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TACR2
Name:Neurokinin 2 receptor
Synonyms:NK-2 receptor | NK-2R | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | SKR | Substance-K receptor | Tachykinin receptor 2
Type:Enzyme Catalytic Domain
Mol. Mass.:43868.63
Organism:mouse
Description:Neurokinin NK2 TACR2 Murine::P16610
Residue:390
Sequence:
MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA
HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQCFYSTITVDEGATK
CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLLVMFGAYSVIGLTLWKRAVPRHQAHGANLR
HLQAKKKFVKAMVLVVLTFAICWLPYHLYFILGTFQEDIYYHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTHTPSLSRRVNRCHTKETLFMT
GDMTHSEATNGQVGSPQDGEPAGPICKAQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030150
NameBDBM50030150
Synonyms:Arg-Pro-Lys-Pro-Gln-Gln-Phe-Dip-Pro-Leu-Met | CHEMBL2372517
TypeSmall organic molecule
Emp. Form.C72H106N18O13S
Mol. Mass.1463.79
SMILES[#6]-[#16]-[#6]-[#6]-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#6])-[#6])-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccccc1)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1-[#6](=O)-[#6@@H](-[#7])-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](-c1ccccc1)-c1ccccc1)-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a