Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 3 receptor
LigandBDBM50030146
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143201
IC50 65±n/a nM
Citation Josien, HLavielle, SBrunissen, ASaffroy, MTorrens, YBeaujouan, JCGlowinski, JChassaing, G Design and synthesis of side-chain conformationally restricted phenylalanines and their use for structure-activity studies on tachykinin NK-1 receptor. J Med Chem37:1586-601 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neurokinin 3 receptor
Name:Neurokinin 3 receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:51128.60
Organism:Rattus norvegicus
Description:ChEMBL_10983
Residue:452
Sequence:
MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRAN
LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS
VAAFNTLINFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP
RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII
LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL
PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW
CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRD
PSANGCSHRGSKSASTTSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030146
NameBDBM50030146
Synonyms:Arg-Pro-Lys-Pro-Gln-Gln-Phe-Tle-Gly-Leu-Met | CHEMBL263852
TypeSmall organic molecule
Emp. Form.C60H100N18O13S
Mol. Mass.1313.614
SMILESCSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCNC(N)=N)C(C)(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a