Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a and A3
LigandBDBM50453443
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30614
Ki 3.1±n/a nM
Citation Kim, HOJi, XDSiddiqi, SMOlah, MEStiles, GLJacobson, KA 2-Substitution of N6-benzyladenosine-5'-uronamides enhances selectivity for A3 adenosine receptors. J Med Chem37:3614-21 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a and A3
Name:Adenosine receptor A2a and A3
Synonyms:Adenosine A3 receptor
Type:PROTEIN
Mol. Mass.:36643.73
Organism:Rattus norvegicus
Description:ChEMBL_479910
Residue:320
Sequence:
MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD
IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY
RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV
FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL
FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR
ACRLCQTSDSLDSNLEQTTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50453443
NameBDBM50453443
Synonyms:CHEMBL2113562
TypeSmall organic molecule
Emp. Form.C19H22IN7O4
Mol. Mass.539.327
SMILESCNC(=O)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NCc3cccc(I)c3)nc(NC)nc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a