Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin/mu opioid receptor
LigandBDBM50033532
Substrate/Competitorn/a
Meas. Tech.ChEMBL_148868
Ki 0.005000±n/a nM
Citation Brine, GAStark, PALiu, YCarroll, FISingh, PXu, HRothman, RB Enantiomers of diastereomeric cis-N-[1-(2-hydroxy-2-phenylethyl)- 3-methyl-4-piperidyl]-N-phenylpropanamides: synthesis, X-ray analysis, and biological activities. J Med Chem38:1547-57 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nociceptin/mu opioid receptor
Name:Nociceptin/mu opioid receptor
Synonyms:MOR-1 | MUOR1 | Mu-type opioid receptor | Mu-type opioid receptor (MOR) | OPIATE Mu | Opiate non-selective | Opioid receptor B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44503.11
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor.
Residue:398
Sequence:
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50033532
NameBDBM50033532
Synonyms:CHEMBL435380 | N-[(3S,4R)-1-((R)-2-Hydroxy-2-phenyl-ethyl)-3-methyl-piperidin-4-yl]-N-phenyl-propionamide | N-[1-(2-Hydroxy-2-phenyl-ethyl)-3-methyl-piperidin-4-yl]-N-phenyl-propionamide(2'R,3S,4R)-cis-ohmefentanyl
TypeSmall organic molecule
Emp. Form.C23H30N2O2
Mol. Mass.366.4965
SMILESCCC(=O)N([C@@H]1CCN(C[C@H](O)c2ccccc2)C[C@@H]1C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a