Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM50052417
Substrate/Competitorn/a
Meas. Tech.ChEMBL_212531
Ki 2.9±n/a nM
Citation Costanzo, MJMaryanoff, BEHecker, LRSchott, MRYabut, SCZhang, HCAndrade-Gordon, PKauffman, JALewis, JMKrishnan, RTulinsky, A Potent thrombin inhibitors that probe the S1 subsite: tripeptide transition state analogues based on a heterocycle-activated carbonyl group. J Med Chem39:3039-43 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50052417
NameBDBM50052417
Synonyms:(S)-1-((R)-2-Methylamino-3-phenyl-propionyl)-pyrrolidine-2-carboxylic acid [(S)-1-(benzooxazole-2-carbonyl)-4-guanidino-butyl]-amide | (S)-N-((S)-1-(benzo[d]oxazol-2-yl)-5-guanidino-1-oxopentan-2-yl)-1-((R)-2-(methylamino)-3-phenylpropanoyl)pyrrolidine-2-carboxamide | CHEMBL105584
TypeSmall organic molecule
Emp. Form.C28H35N7O4
Mol. Mass.533.622
SMILESCN[C@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)c1nc2ccccc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a