Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDOPAMINE
LigandBDBM50054091
Substrate/Competitorn/a
Meas. Tech.ChEMBL_58656
Ki 26±n/a nM
Citation Claudi, FCingolani, GMDi Stefano, AGiorgioni, GAmenta, FBarili, PFerrari, FGiuliani, D Synthesis, resolution, and preliminary evaluation of trans-2-amino-6(5)-hydroxy-1-phenyl-2,3-dihydro-1H-indenes and related derivatives as dopamine receptors ligands. J Med Chem39:4238-46 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DOPAMINE
Name:Dopamine receptors; D1 & D2
Synonyms:D(1A) dopamine receptor | DOPAMINE D1 | Dopamine D1 high | Dopamine D1 low | Dopamine receptor | Dopamine receptor D1 | Dopamine1-like
Type:Enzyme Catalytic Domain
Mol. Mass.:49429.75
Organism:RAT
Description:DOPAMINE 0 RAT::P18901
Residue:446
Sequence:
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED
TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN
CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS
EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054091
NameBDBM50054091
Synonyms:(2R,3R)-2-Dipropylamino-3-phenyl-indan-5-ol | CHEMBL335515
TypeSmall organic molecule
Emp. Form.C21H27NO
Mol. Mass.309.4452
SMILESCCCN(CCC)[C@@H]1Cc2ccc(O)cc2[C@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a