Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM50060601
Substrate/Competitorn/a
Meas. Tech.ChEMBL_59621
Ki 0.040000±n/a nM
Citation Baures, PWOjala, WHCostain, WJOtt, MCPradhan, AGleason, WBMishra, RKJohnson, RL Design, synthesis, and dopamine receptor modulating activity of diketopiperazine peptidomimetics of L-prolyl-L-leucylglycinamide. J Med Chem40:3594-600 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DRD2
Name:Dopamine receptor
Synonyms:DOPAMINE D2 | Dopamine D2 receptor | Dopamine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:50698.79
Organism:BOVINE
Description:DOPAMINE D2 DRD2 BOVINE::P20288
Residue:444
Sequence:
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060601
NameBDBM50060601
Synonyms:(E)-6-(3-oxo-3-phenylprop-1-enyl)pyrimidine-2,4(1H,3H)-dione | (S)-Pyrrolidine-2-carboxylic acid [(S)-1-(carbamoylmethyl-carbamoyl)-3-methyl-butyl]-amide | 6-((E)-3-Oxo-3-phenyl-propenyl)-1H-pyrimidine-2,4-dione | CHEMBL317488 | L-pro-L-leu-gly-NH2 | L-prolyl-L-leucylglycinamide | Pyrrolidine-2-carboxylic acid [1-(carbamoylmethyl-carbamoyl)-3-methyl-butyl]-amide
TypeSmall organic molecule
Emp. Form.C13H24N4O3
Mol. Mass.284.3547
SMILESCC(C)C[C@H](NC(=O)[C@@H]1CCCN1)C(=O)NCC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a