Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM50060602
Substrate/Competitorn/a
Meas. Tech.ChEMBL_59622
Ki 0.050000±n/a nM
Citation Baures, PWOjala, WHCostain, WJOtt, MCPradhan, AGleason, WBMishra, RKJohnson, RL Design, synthesis, and dopamine receptor modulating activity of diketopiperazine peptidomimetics of L-prolyl-L-leucylglycinamide. J Med Chem40:3594-600 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DRD2
Name:Dopamine receptor
Synonyms:DOPAMINE D2 | Dopamine D2 receptor | Dopamine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:50698.79
Organism:BOVINE
Description:DOPAMINE D2 DRD2 BOVINE::P20288
Residue:444
Sequence:
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060602
NameBDBM50060602
Synonyms:2-[3-((2R,8aS)-1,4-Dioxo-hexahydro-pyrrolo[1,2-a]pyrazin-2-yl)-2-oxo-pyrrolidin-1-yl]-acetamide
TypeSmall organic molecule
Emp. Form.C13H18N4O4
Mol. Mass.294.3064
SMILESNC(=O)CN1CCC(N2CC(=O)N3CCC[C@H]3C2=O)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a