Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin A receptor
LigandBDBM21147
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49725
Ki 0.280000±n/a nM
Citation Blommaert, AGDhôtel, HDucos, BDurieux, CGoudreau, NBado, AGarbay, CRoques, BP Structure-based design of new constrained cyclic agonists of the cholecystokinin CCK-B receptor. J Med Chem40:647-58 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin A receptor
Name:Cholecystokinin A receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:48229.77
Organism:Cavia porcellus
Description:n/a
Residue:430
Sequence:
MDVVDSLFVNGSNITSACELGFENETLFCLDRPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPSLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTGNMCRFLLPNDVMQQTWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFDAIQKKSAKERKTSTGSSGPMEDSDGCYLQKSRHPRKLELRQLSPSSSGSNRINRIRS
SSSTANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAERHLSGTPISFILLL
SYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGTPGVRGEMGEEEEGRTTGASLSRYSY
SHMSTSAPPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21147
NameBDBM21147
Synonyms:(3S)-3-[(2S)-2-[(2S)-2-{2-[(2S)-2-[(2S)-2-[(3S)-3-amino-3-formamidopropanoic acid]-3-[4-(sulfooxy)phenyl]propanamido]-4-(methylsulfanyl)butanamido]acetamido}-3-(1H-indol-3-yl)propanamido]-4-(methylsulfanyl)butanamido]-3-{[(1S)-1-carbamoyl-2-phenylethyl]carbamoyl}propanoic acid | CCK-8 | CCK-8(SO3) | CHEMBL1121 | H-Asp-Tyr(SO3H)-Met-Gly-Trp-Met-Asp-Phe-NH2 | SINCALIDE | Syncalide | [125I]CCK-8
Typeradiolabeled ligand
Emp. Form.C49H62N10O16S3
Mol. Mass.1143.269
SMILESCSCC[C@H](NC(=O)[C@H](Cc1ccc(OS(O)(=O)=O)cc1)NC(=O)[C@@H](N)CC(O)=O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a