Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor
LigandBDBM50046728
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138672
Ki 1.1±n/a nM
Citation Messer, WSAbuh, YFLiu, YPeriyasamy, SNgur, DOEdgar, MAEl-Assadi, AASbeih, SDunbar, PGRoknich, SRho, TFang, ZOjo, BZhang, HHuzl, JJNagy, PI Synthesis and biological characterization of 1,4,5,6-tetrahydropyrimidine and 2-amino-3,4,5,6-tetrahydropyridine derivatives as selective m1 agonists. J Med Chem40:1230-46 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor
Name:Muscarinic acetylcholine receptor
Synonyms:Cholinergic receptor, muscarinic 1, CNS | Cholinergic, muscarinic | Muscarinic acetylcholine receptor M1
Type:Enzyme Catalytic Domain
Mol. Mass.:51400.50
Organism:Mus musculus
Description:Cholinergic, muscarinic 0 0::Q52KQ0
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046728
NameBDBM50046728
Synonyms:1-Methyl-5-(3-methyl-[1,2,4]oxadiazol-5-yl)-1,2,3,6-tetrahydro-pyridine | CHEMBL12378
TypeSmall organic molecule
Emp. Form.C9H13N3O
Mol. Mass.179.219
SMILESCN1CCC=C(C1)c1nc(C)no1 |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a