Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRA
LigandBDBM50065508
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63353
IC50 5±n/a nM
Citation Astles, PCBrealey, CBrown, TJFacchini, VHandscombe, CHarris, NVMcCarthy, CMcLay, IMPorter, BRoach, AGSargent, CSmith, CWalsh, RJ Selective endothelin A receptor antagonists. 3. Discovery and structure-activity relationships of a series of 4-phenoxybutanoic acid derivatives. J Med Chem41:2732-44 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EDNRA
Name:Endothelin receptor
Synonyms:ENDOTHELIN A | Endothelin receptor | Endothelin-1 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48256.91
Organism:RAT
Description:ENDOTHELIN A EDNRA RAT::P26684
Residue:426
Sequence:
MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALP
SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCM
LNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS
HKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065508
NameBDBM50065508
Synonyms:(R)-4-[2-Cyano-5-(thiophen-3-ylmethoxy)-phenoxy]-4-o-tolyl-butyric acid | CHEMBL94071
TypeSmall organic molecule
Emp. Form.C23H21NO4S
Mol. Mass.407.482
SMILESCc1ccccc1[C@@H](CCC(O)=O)Oc1cc(OCc2ccsc2)ccc1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a