Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM50088245
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30014
Ki 6.3±n/a nM
Citation Wintner, EAMoallemi, CC Quantized surface complementarity diversity (QSCD): a model based on small molecule-target complementarity. J Med Chem43:1993-2006 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088245
NameBDBM50088245
Synonyms:4-[6-Amino-2-(4-formyl-phenylethynyl)-purin-9-yl]-2,3-dimethoxy-cyclopentanecarboxylic acid ethylamide
TypeSmall organic molecule
Emp. Form.C24H26N6O4
Mol. Mass.462.501
SMILESCCNC(=O)[C@H]1CC([C@H](OC)[C@@H]1OC)n1cnc2c(N)nc(nc12)C#Cc1ccc(C=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a