Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM50098843
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197663
Ki 43.5±n/a nM
Citation Akahoshi, FAshimori, ASakashita, HYoshimura, TImada, TNakajima, MMitsutomi, NKuwahara, SOhtsuka, TFukaya, CMiyazaki, MNakamura, N Synthesis, structure-activity relationships, and pharmacokinetic profiles of nonpeptidic alpha-keto heterocycles as novel inhibitors of human chymase. J Med Chem44:1286-96 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chymase
Name:Chymase
Synonyms:Alpha-chymase | Chymase precursor | Mast cell protease I
Type:Enzyme
Mol. Mass.:27340.12
Organism:Homo sapiens (Human)
Description:n/a
Residue:247
Sequence:
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098843
NameBDBM50098843
Synonyms:2-{2-[2-(5-Amino-6-oxo-2-pyridin-4-yl-6H-pyrimidin-1-yl)-acetylamino]-3-phenyl-propionyl}-benzooxazole-5-carboxylic acid methyl ester | CHEMBL23999
TypeSmall organic molecule
Emp. Form.C29H24N6O6
Mol. Mass.552.5375
SMILESCOC(=O)c1ccc2oc(nc2c1)C(=O)C(Cc1ccccc1)NC(=O)Cn1c(ncc(N)c1=O)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a