Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylosuccinate synthetase 2
LigandBDBM50149248
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29913
IC50 3500±n/a nM
Citation Erlanson, DAMcDowell, RSO'Brien, T Fragment-based drug discovery. J Med Chem47:3463-82 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenylosuccinate synthetase 2
Name:Adenylosuccinate synthetase 2
Synonyms:AMPSase 2 | AdSS 2 | Adenylosuccinate synthetase isozyme 2 | Adenylosuccinate synthetase, acidic isozyme | IMP--aspartate ligase 2
Type:PROTEIN
Mol. Mass.:50096.76
Organism:Homo sapiens (Human)
Description:ChEMBL_29913
Residue:456
Sequence:
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50149248
NameBDBM50149248
Synonyms:(Formyl-hydroxy-amino)-acetic acid | CHEMBL331373 | HADACIDIN
TypeSmall organic molecule
Emp. Form.C3H5NO4
Mol. Mass.119.0761
SMILESON(CC(O)=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a