Target
Carbonic anhydrase
Ligand
BDBM26981
Substrate
n/a
Meas. Tech.
ChEMBL_302990
Ki
13200000±n/a nM
Citation
 Innocenti, AZimmerman, SFerry, JGScozzafava, ASupuran, CT Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. Bioorg Med Chem Lett 14:4563-7 (2004) [PubMed]  Article
Target
Name:
Carbonic anhydrase
Synonyms:
n/a
Type:
PROTEIN
Mol. Mass.:
19556.84
Organism:
Methanobacterium thermoautotrophicum
Description:
ChEMBL_1280426
Residue:
176
Sequence:
MRFVSMIIKDILRENQDFRFRDLSDLKHSPKLCIITCMDSRLIDLLERALGIGRGDAKVIKNAGNIVDDGVIRSAAVAIYALGVNEIIIVGHTDCGMARLDEDLIVSRMRELGVEEEVIENFSIDVLNPVGDEEENVIEGVKRLKSSPLIPESIGVHGLIIDINTGRLKPLYLDED
  
Inhibitor
Name:
BDBM26981
Synonyms:
CHEMBL1644695 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
Type:
Ion
Emp. Form.:
I
Mol. Mass.:
126.90502
SMILES:
[I-]
Structure:
Search PDB for entries with ligand similarity: