Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-secretase 1
LigandBDBM50152294
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304885
IC50 50±n/a nM
Citation Rajamani, RReynolds, CH Modeling the binding affinities of beta-secretase inhibitors: application to subsite specificity. Bioorg Med Chem Lett14:4843-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-secretase 1
Name:Beta-secretase 1
Synonyms:ASP2 | Asp 2 | Aspartyl protease 2 | BACE | BACE1 | Beta-secretase 1 (BACE 1) | Beta-secretase 1 (BACE-1) | Beta-secretase 1 (BACE1) | Beta-site APP cleaving enzyme 1 | Beta-site amyloid precursor protein cleaving enzyme 1 | KIAA1149 | Memapsin-2 | Membrane-associated aspartic protease 2 | beta-Secretase (BACE-1) | beta-Secretase (BACE1)
Type:Protein
Mol. Mass.:55755.10
Organism:Homo sapiens (Human)
Description:P56817
Residue:501
Sequence:
MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRQQHDDFADDISLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152294
NameBDBM50152294
Synonyms:4-[5-(3,5-difluorophenyl)-4-(3-dipropylcarbamoylphenylcarboxamido)-1-ethyl-3-hydroxypentylcarboxamidomethyl]-1-cyclohexanecarboxylic acid | CHEMBL364406
TypeSmall organic molecule
Emp. Form.C36H49F2N3O6
Mol. Mass.657.7876
SMILESCCCN(CCC)C(=O)c1cccc(c1)C(=O)N[C@@H](Cc1cc(F)cc(F)c1)[C@@H](O)C[C@@H](CC)C(=O)NC[C@H]1CCC(CC1)C(O)=O |wU:18.18,38.39,wD:31.35,28.30,(-12.85,2.46,;-11.51,1.7,;-11.49,.15,;-10.16,-.61,;-10.16,-2.15,;-11.49,-2.92,;-11.49,-4.46,;-8.83,.15,;-8.83,1.7,;-7.5,-.63,;-7.5,-2.17,;-6.19,-2.94,;-4.83,-2.16,;-4.86,-.61,;-6.19,.15,;-3.51,.15,;-3.52,1.7,;-2.17,-.63,;-.84,.14,;-.83,1.7,;.04,3.37,;.01,4.91,;1.34,5.67,;1.34,7.22,;2.69,4.91,;2.69,3.37,;4.02,2.6,;1.37,2.6,;.5,-.63,;.5,-2.17,;1.82,.14,;3.16,-.63,;3.16,-2.17,;1.83,-2.94,;4.48,.14,;4.46,1.32,;5.84,-.63,;7.17,.15,;8.52,-.61,;9.84,.15,;11.17,-.61,;11.18,-2.15,;9.87,-2.92,;8.52,-2.15,;12.51,-2.91,;12.51,-4.44,;13.84,-2.13,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a